Freja
Retail brand
- Products tracked
- 8
- Product claims
- 28
Overview
What Freja covers.
Freja New York is a fashion brand that specializes in handcrafted bags and accessories designed for professional and everyday use. The brand focuses on minimalist aesthetics and functional design, catering to consumers seeking versatile, high-quality leather goods. It is headquartered in New York City.
- Talio tracks 8 products for Freja.
- Positioned as a challenger brand.
- Tracked products include freja chocolate collagen protein shake, freja beef bone broth 500ml and freja bone broth concentrate grass-fed beef 300g.
- Ingredients declared most often across its range: coconut sugar, water and bay leaf.
- Products carry claims including Dairy Free, Gluten Free and Grass Fed.
- Headquartered in United States.
- Talio tracks 9,271 food and beverage companies headquartered or distributing in United States. Browse Companies in United States
- Talio tracks 7,819 food and beverage brands headquartered or distributing in United States. Browse Brands in United States
- Talio tracks 539 food and beverage companies with products in Collagen Protein. Browse Companies in Collagen Protein
- Talio tracks 121 food and beverage companies with products in Stocks & Bouillon. Browse Companies in Stocks & Bouillon
Products
6 of 8 products Talio tracks for Freja.
freja chocolate collagen protein shake
nordic bone broth powdercoconut sugarcocoa powderchocolatefreja beef bone broth 500ml
wateronioncarrotparsnipleeksaltparsleythymefreja bone broth concentrate grass-fed beef 300g
beef bonewatersaltfreja chicken bone broth 500ml
wateronioncarrotsea saltrosemarythymebay leafblack pepperfreja collagen protein chocolate shake 300g
coconut sugarcacao powdernatural flavoringnordic beef bone broth powderfreja collagen protein shake strawberry 300g
coconut sugarfreeze dried strawberry powdernordic bone broth powdernatural flavouring strawberry
Most-used ingredients & product claims
Most-used ingredients
Product claims
FAQ
Questions this page answers.
What does Freja do?
Freja is a food and beverage brand based in United States, tracked in Talio's food and beverage intelligence platform.
What products does Freja make?
Talio tracks 8 products for Freja, including freja chocolate collagen protein shake, freja beef bone broth 500ml and freja bone broth concentrate grass-fed beef 300g.
What claims do Freja products carry?
Talio tracks 28 marketing claims across Freja products, including Dairy Free, Gluten Free and Grass Fed.
Is this the full Talio record?
No. This page is a public preview; proprietary metrics and workflow features remain inside authenticated Talio.
Proprietary metrics remain in authenticated Talio.
