Kemps
Retail brand
- Products tracked
- 95
- Product claims
- 50
Overview
What Kemps covers.
Farmer Owned. Family Loved. Higher standards. Happier families. Healthier communities.
- Talio tracks 95 products for Kemps.
- Positioned as a mainstream brand.
- Tracked products include blueberry nonfat yogurt 5lb, chive cottage cheese 4-pack and golden egg nog quart.
- Ingredients declared most often across its range: carrageenan, salt and vitamin a palmitate.
- Products carry claims including No Artificial Growth Hormones, Farmer Owned and Source of Protein.
- Headquartered in United States.
- Talio tracks 9,285 food and beverage companies headquartered or distributing in United States. Browse Companies in United States
- Talio tracks 7,833 food and beverage brands headquartered or distributing in United States. Browse Brands in United States
- Talio tracks 341 food and beverage companies with products in Dairy. Browse Companies in Dairy
- Talio tracks 112 food and beverage companies with products in Dairy Drinkable. Browse Companies in Dairy Drinkable
- Talio tracks 236 food and beverage companies with products in Dairy Spoonable. Browse Companies in Dairy Spoonable
- Talio tracks 188 food and beverage companies with products in Fresh. Browse Companies in Fresh
- Talio tracks 119 food and beverage companies with products in Dairy-Based Dips. Browse Companies in Dairy-Based Dips
- Talio tracks 368 food and beverage companies with products in Ice Cream, Gelato & Sorbet, Ice Lollies & Popsicles, Frozen Cakes. Browse Companies in Ice Cream, Gelato & Sorbet, Ice Lollies & Popsicles, Frozen Cakes
- Talio tracks 448 food and beverage companies with products in Juices, Smoothies & Shots. Browse Companies in Juices, Smoothies & Shots
- Talio tracks 215 food and beverage companies with products in Milk & Milk-Based Drinks (RTD). Browse Companies in Milk & Milk-Based Drinks (RTD)
- Talio links 6 food and beverage brands to Dairy Farmers of America, Inc.. Browse Brands owned by Dairy Farmers of America, Inc.
Products
6 of 95 products Talio tracks for Kemps.
blueberry nonfat yogurt 5lb
cultured skim milksugarwaterfood starch-modifiedblueberrynatural flavorcarrageenanpectinchive cottage cheese 4-pack
cultured nonfat milkcreamwheysaltchivespicemaltodextringuar gumgolden egg nog quart
skim milkcreamsugarcorn syrupegg yolknatural and artificial flavorsnutmegwaterkemps 1 lowfat cottage cheese 564oz
cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gumkemps 1 lowfat small curd cottage cheese 16 oz
cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gumkemps 1 lowfat small curd cottage cheese 22 oz
cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gum
Most-used ingredients & product claims
Most-used ingredients
Product claims
FAQ
Questions this page answers.
What does Kemps do?
Kemps is a food and beverage brand based in United States, tracked in Talio's food and beverage intelligence platform.
What products does Kemps make?
Talio tracks 95 products for Kemps, including blueberry nonfat yogurt 5lb, chive cottage cheese 4-pack and golden egg nog quart.
What claims do Kemps products carry?
Talio tracks 50 marketing claims across Kemps products, including No Artificial Growth Hormones, Farmer Owned and Source of Protein.
Is this the full Talio record?
No. This page is a public preview; proprietary metrics and workflow features remain inside authenticated Talio.
People at Kemps
Reach the team directly.
Approximate team size: 1.0K people · names and emails are hidden.
Proprietary metrics remain in authenticated Talio.