food and beverage brandUpdated 28 Mar 2026

Kemps

Retail brand

Products tracked
95
Product claims
50
Is this your company?Claim Kemps to get found by buyers, add products and certifications, and earn the Verified badge once you’ve reviewed your details — staying eligible when Talio’s AI recommends suppliers.Let our AI make the introductionGet a warm, researched intro to Kemps — no cold outreach.

Overview

What Kemps covers.

Farmer Owned. Family Loved. Higher standards. Happier families. Healthier communities.

  • Talio tracks 95 products for Kemps.
  • Positioned as a mainstream brand.
  • Tracked products include blueberry nonfat yogurt 5lb, chive cottage cheese 4-pack and golden egg nog quart.
  • Ingredients declared most often across its range: carrageenan, salt and vitamin a palmitate.
  • Products carry claims including No Artificial Growth Hormones, Farmer Owned and Source of Protein.
  • Headquartered in United States.

Products

6 of 95 products Talio tracks for Kemps.

  • blueberry nonfat yogurt 5lb

    cultured skim milksugarwaterfood starch-modifiedblueberrynatural flavorcarrageenanpectin
  • chive cottage cheese 4-pack

    cultured nonfat milkcreamwheysaltchivespicemaltodextringuar gum
  • golden egg nog quart

    skim milkcreamsugarcorn syrupegg yolknatural and artificial flavorsnutmegwater
  • kemps 1 lowfat cottage cheese 564oz

    cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gum
  • kemps 1 lowfat small curd cottage cheese 16 oz

    cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gum
  • kemps 1 lowfat small curd cottage cheese 22 oz

    cultured skim milkskim milkwhey protein concentratecreamsaltguar gummono and diglyceridescarob bean gum

Most-used ingredients & product claims

Most-used ingredients

Product claims

FAQ

Questions this page answers.

What does Kemps do?

Kemps is a food and beverage brand based in United States, tracked in Talio's food and beverage intelligence platform.

What products does Kemps make?

Talio tracks 95 products for Kemps, including blueberry nonfat yogurt 5lb, chive cottage cheese 4-pack and golden egg nog quart.

What claims do Kemps products carry?

Talio tracks 50 marketing claims across Kemps products, including No Artificial Growth Hormones, Farmer Owned and Source of Protein.

Is this the full Talio record?

No. This page is a public preview; proprietary metrics and workflow features remain inside authenticated Talio.

People at Kemps

Reach the team directly.

Approximate team size: 1.0K people · names and emails are hidden.

Unlock emails

Own this company?

Get found by buyers — and the AI that recommends suppliers.

Claim this profile to appear in buyer searches, add your products and certifications, and correct outdated details. Once you've claimed the page and reviewed its details, it carries the Verified badge — and stays eligible when Talio's AI recommends suppliers.

Claiming grants reviewed submission rights only — not direct editing, suppression, or ownership of Talio-derived intelligence. Verification required.

Proprietary metrics remain in authenticated Talio.