Wellbeing Nutrition
Retail brand
- Products tracked
- 175
- Product claims
- 310
Overview
What Wellbeing Nutrition covers.
India's first one-stop-shop for organic whole foods and science-backed multivitamin supplements — rooted in Ayurveda, backed by science.
- Talio tracks 175 products for Wellbeing Nutrition.
- Positioned as a challenger brand.
- Tracked products include 3x strength omega 3 fish oil, 4x strength omega 3 fish oil and 6x strength omega 3 fish oil capsule.
- Ingredients declared most often across its range: brown rice protein isolate, chia seed protein and golden european pea protein isolate.
- Products carry claims including No Added Sugar, Clinically Proven and High in Protein.
- Talio tracks 657 food and beverage companies with products in Adaptogen Powders. Browse Companies in Adaptogen Powders
- Talio tracks 868 food and beverage companies with products in B Vitamins & Folate. Browse Companies in B Vitamins & Folate
- Talio tracks 462 food and beverage companies with products in BCAAs & Amino Acids. Browse Companies in BCAAs & Amino Acids
- Talio tracks 331 food and beverage companies with products in Blended Greens Powders. Browse Companies in Blended Greens Powders
- Talio tracks 318 food and beverage companies with products in Calcium. Browse Companies in Calcium
- Talio tracks 716 food and beverage companies with products in Collagen Powders. Browse Companies in Collagen Powders
- Talio tracks 529 food and beverage companies with products in Collagen Protein. Browse Companies in Collagen Protein
- Talio tracks 118 food and beverage companies with products in Complete Nutrition. Browse Companies in Complete Nutrition
Products
6 of 175 products Talio tracks for Wellbeing Nutrition.
3x strength omega 3 fish oil
4x strength omega 3 fish oil
fish oilcurcuminpeppermint oillemonmint6x strength omega 3 fish oil capsule
fish oilcurcuminpeppermint oilacidity calm acid reflux heartburn relief for seniors 15 sachets
acidity relief
amlacarawayfennelmintaniseapple cider vinegar
Distributors
Talio links this brand to the distributors below. Each link is stated for the territory it applies to.
Most-used ingredients & product claims
Most-used ingredients
Product claims
FAQ
Questions this page answers.
What does Wellbeing Nutrition do?
Wellbeing Nutrition is a food and beverage brand, tracked in Talio's food and beverage intelligence platform.
What products does Wellbeing Nutrition make?
Talio tracks 175 products for Wellbeing Nutrition, including 3x strength omega 3 fish oil, 4x strength omega 3 fish oil and 6x strength omega 3 fish oil capsule.
What claims do Wellbeing Nutrition products carry?
Talio tracks 310 marketing claims across Wellbeing Nutrition products, including No Added Sugar, Clinically Proven and High in Protein.
Is this the full Talio record?
No. This page is a public preview; proprietary metrics and workflow features remain inside authenticated Talio.
Proprietary metrics remain in authenticated Talio.
